NDST4 Antibody

Name NDST4 Antibody
Supplier Novus Biologicals
Catalog NBP1-62254
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the N terminal of NDST4. Peptide sequence EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NDST4
Conjugate Unconjugated
Supplier Page Shop

Product images