AADAC Antibody

Name AADAC Antibody
Supplier Novus Biologicals
Catalog NBP1-62428
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AADAC(arylacetamide deacetylase (esterase)) The peptide sequence was selected from the N terminal of AADAC. Peptide sequence AHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene AADAC
Conjugate Unconjugated
Supplier Page Shop

Product images