NDST4 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62410
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to NDST4(N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 4) The peptide sequence was selected from the middle region of NDST4. Peptide sequence YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: NDST4
• Conjugate: Unconjugated