CYP2A13 Antibody

Name CYP2A13 Antibody
Supplier Novus Biologicals
Catalog NBP1-62400
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP2A13(cytochrome P450, family 2, subfamily A, polypeptide 13) The peptide sequence was selected from the C terminal of CYP2A13. Peptide sequence DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene CYP2A13
Conjugate Unconjugated
Supplier Page Shop

Product images