Name | CYP2A13 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62400 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CYP2A13(cytochrome P450, family 2, subfamily A, polypeptide 13) The peptide sequence was selected from the C terminal of CYP2A13. Peptide sequence DPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELF. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | CYP2A13 |
Conjugate | Unconjugated |
Supplier Page | Shop |