Name | ST3 beta-Gal alpha-2,3-Sialyltransferase 1/ST3GAL1/SIAT4A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62540 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ST3GAL1(ST3 beta-galactoside alpha-2,3-sialyltransferase 1) The peptide sequence was selected from the C terminal of ST3GAL1. Peptide sequence YVFDNWLQGHGRYPSTGILSVIFSMHVCDEVDLYGFGADSKGNWHHYWEN. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ST3GAL1 |
Conjugate | Unconjugated |
Supplier Page | Shop |