SLC5A8/SMCT1 Antibody

Name SLC5A8/SMCT1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62527
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC5A8(solute carrier family 5 (iodide transporter), member 8) The peptide sequence was selected from the middle region of SLC5A8. Peptide sequence GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SLC5A8
Conjugate Unconjugated
Supplier Page Shop

Product images