Name | SLC5A8/SMCT1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62527 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC5A8(solute carrier family 5 (iodide transporter), member 8) The peptide sequence was selected from the middle region of SLC5A8. Peptide sequence GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC5A8 |
Conjugate | Unconjugated |
Supplier Page | Shop |