SLC22A8 Antibody

Name SLC22A8 Antibody
Supplier Novus Biologicals
Catalog NBP1-60107
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Dog
Antigen Synthetic peptides corresponding to SLC22A8(solute carrier family 22 (organic anion transporter), member 8) The peptide sequence was selected from the middle region of SLC22A8. Peptide sequence PETLNQPLPETIEDLENWSLRAKKPKQEPEVEKASQRIPLQPHGP
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC22A8
Supplier Page Shop

Product images