Synaptic glycoprotein SC2 Antibody
| Name | Synaptic glycoprotein SC2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-60088 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GPSN2(glycoprotein, synaptic 2) The peptide sequence was selected from the middle region of GPSN2. Peptide sequence PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TECR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Synaptic glycoprotein SC2 Antibody [NBP1-60088] - 721_B cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7308_Synaptic-glycoprotein-SC2-Antibody-Western-Blot-NBP1-60088-img0002.jpg)
![Western Blot: Synaptic glycoprotein SC2 Antibody [NBP1-60088] - Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7309_Synaptic%2520glycoprotein%2520SC2%2520Antibody-Western%2520Blot-NBP1-60088-img0003.jpg)