DC-SIGNR/CD299/CLEC4M Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59183
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CLEC4M (C-type lectin domain family 4, member M) The peptide sequence was selected from the middle region of CLEC4M)(50ug). Peptide sequence NRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFS.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CLEC4M
• Conjugate: Unconjugated