LAT3 Antibody
| Name | LAT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59431 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC43A1(solute carrier family 43, member 1) The peptide sequence was selected from the middle region of SLC43A1. Peptide sequence AVNKMLEYLVTGGQEHETNEQQQKVAETVGFYSSVFGAMQLLCLLTCPLI. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC43A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: LAT3 Antibody [NBP1-59431] - Sample Type: Human Fetal Liver Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24605_LAT3-Antibody-Western-Blot-NBP1-59431-img0004.jpg)
![Western Blot: LAT3 Antibody [NBP1-59431] - Human Placenta lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24606_LAT3-Antibody-Western-Blot-NBP1-59431-img0003.jpg)