C16orf73 Antibody
| Name | C16orf73 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-70440 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C16orf73 (chromosome 16 open reading frame 73) The peptide sequence was selected from the middle region of C16orf73. Peptide sequence CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MEIOB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: C16orf73 Antibody [NBP1-70440] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7001_C16orf73-Antibody-Western-Blot-NBP1-70440-img0002.jpg)
![Western Blot: C16orf73 Antibody [NBP1-70440] - Antibody Titration: 1 ug/ml Positive control: Human Lung.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7002_C16orf73%2520Antibody-Western%2520Blot-NBP1-70440-img0003.jpg)