HISPPD1 Antibody

Name HISPPD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54642
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HISPPD1(histidine acid phosphatase domain containing 1) The peptide sequence was selected from the middle region of HISPPD1. Peptide sequence SLSSCQQRVKARLHEILQKDRDFTAEDYEKLTPSGSISLIKSMHLIKNPV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PPIP5K2
Conjugate Unconjugated
Supplier Page Shop

Product images