NKD2 Antibody

Name NKD2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54733
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to NKD2 (naked cuticle homolog 2 (Drosophila)) The peptide sequence was selected from the N terminal of NKD2. Peptide sequence ARDKQELPNGDPKEGPFREDQCPLQVALPAEKAEGREHPGQLLSADDGER.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene NKD2
Conjugate Unconjugated
Supplier Page Shop

Product images