TMLHE Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-54725
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to TMLHE(trimethyllysine hydroxylase, epsilon) The peptide sequence was selected from the middle region of TMLHE. Peptide sequence PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: TMLHE
• Conjugate: Unconjugated

Product images

Western Blot: TMLHE Antibody [NBP1-54725] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.