Name | UbcH8/Ube2L6 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55036 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Pig, Rabbit |
Antigen | Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the N terminal of UBE2L6. Peptide sequence LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | UBE2L6 |
Supplier Page | Shop |