UbcH8/Ube2L6 Antibody
| Name | UbcH8/Ube2L6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55036 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Pig, Rabbit |
| Antigen | Synthetic peptides corresponding to UBE2L6(ubiquitin-conjugating enzyme E2L 6) The peptide sequence was selected from the N terminal of UBE2L6. Peptide sequence LLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICL. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | UBE2L6 |
| Supplier Page | Shop |
Product images
![Western Blot: Ube2L6 Antibody [NBP1-55036] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14055_Ube2L6%2520Antibody-Western%2520Blot-NBP1-55036-img0002.jpg)
Western Blot: Ube2L6 Antibody [NBP1-55036] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.