GABARAPL1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55203
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GABARAPL1(GABA(A) receptor-associated protein like 1) The peptide sequence was selected from the middle region of GABARAPL1. Peptide sequence KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GABARAPL1
• Conjugate: Unconjugated