CYP11B1 Antibody

Name CYP11B1 Antibody
Supplier Novus Biologicals
Catalog NBP1-68883
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB IHC
Species Reactivities Human, Monkey
Antigen Synthetic peptides corresponding to CYP11B1 (cytochrome P450, family 11, subfamily B, polypeptide 1) The peptide sequence was selected from the C terminal of CYP11B1. Peptide sequence ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYP11B1
Conjugate Unconjugated
Supplier Page Shop

Product images