ABCB9 Antibody
| Name | ABCB9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69513 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ABCB9(ATP-binding cassette, sub-family B (MDR/TAP), member 9) The peptide sequence was selected from the N terminal of ABCB9. Peptide sequence RLWKAVVVTLAFMSVDICVTTAIYVFSHLDRSLLEDIRHFNIFDSVLDLW. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ABCB9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ABCB9 Antibody [NBP1-69513] - This Anti-ABCB9 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15801_ABCB9%2520Antibody-Western%2520Blot-NBP1-69513-img0001.jpg)
Western Blot: ABCB9 Antibody [NBP1-69513] - This Anti-ABCB9 antibody was used in Western Blot of Fetal Lung tissue lysate at a concentration of 1ug/ml.