RNF43 Antibody
| Name | RNF43 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69499 |
| Prices | $329.00 |
| Sizes | 50 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to RNF43(ring finger protein 43) The peptide sequence was selected from the middle region of RNF43. Peptide sequence DFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RNF43 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RNF43 Antibody [NBP1-69499] - This Anti-RNF43 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14979_RNF43-Antibody-Western-Blot-NBP1-69499-img0001.jpg)
Western Blot: RNF43 Antibody [NBP1-69499] - This Anti-RNF43 antibody was used in Western Blot of MCF7 tissue lysate at a concentration of 1ug/ml.