SRp55 Antibody

Name SRp55 Antibody
Supplier Novus Biologicals
Catalog NBP1-57112
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SFRS6(splicing factor, arginine/serine-rich 6) The peptide sequence was selected from the middle region of SFRS6. Peptide sequence KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SRSF6
Conjugate Unconjugated
Supplier Page Shop

Product images