SLC22A7 Antibody
| Name | SLC22A7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69691 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the C terminal of SLC22A7. Peptide sequence LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQE |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SLC22A7 |
| Supplier Page | Shop |
Product images
![Western Blot: SLC22A7 Antibody [NBP1-69691] - This Anti-SLC22A7 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14163_SLC22A7%2520Antibody-Western%2520Blot-NBP1-69691-img0001.jpg)
Western Blot: SLC22A7 Antibody [NBP1-69691] - This Anti-SLC22A7 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 0.25ug/ml.