| Name | C2GNT3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69591 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to GCNT4(glucosaminyl (N-acetyl) transferase 4, core 2 ) The peptide sequence was selected from the C terminal of GCNT4. Peptide sequence SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | GCNT4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |