EDAR Antibody
| Name | EDAR Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-69709 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | Synthetic peptides corresponding to EDAR(ectodysplasin A receptor) The peptide sequence was selected from the middle region of EDAR. Peptide sequence PAPDKQGSPELCLLSLVHLAREKSATSNKSAGIQSRRKKILDVYANVCGV. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | EDAR |
| Supplier Page | Shop |
Product images
![Western Blot: EDAR Antibody [NBP1-69709] - This Anti-EDAR antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/14194_EDAR%2520Antibody-Western%2520Blot-NBP1-69709-img0001.jpg)
Western Blot: EDAR Antibody [NBP1-69709] - This Anti-EDAR antibody was used in Western Blot of Placenta tissue lysate at a concentration of 1ug/ml.