CHST8 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-69273
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CHST8(carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 8) The peptide sequence was selected from the middle region of CHST8. Peptide sequence GCSNWKRVLMVLAGLASSTADIQHNTVHYGSALKRLDTFDRQGILHRLST.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CHST8
• Conjugate: Unconjugated

Product images

Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - This Anti-CHST8 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 0.25ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: CHST8 Antibody [NBP1-69273] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.