C3orf39 Antibody
| Name | C3orf39 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79305 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human C3orf39The immunogen for this antibody is C3ORF39. Peptide sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | POMGNT2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C3orf39 Antibody [NBP1-79305] - HepG2 cell lysate, concentration 1.25ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15713_C3orf39%2520Antibody-Western%2520Blot-NBP1-79305-img0002.jpg)
Western Blot: C3orf39 Antibody [NBP1-79305] - HepG2 cell lysate, concentration 1.25ug/ml.