METTL14 Antibody
| Name | METTL14 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79389 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human KIAA1627. Peptide sequence LNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDEL. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | METTL14 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: METTL14 Antibody [NBP1-79389] - Sample Tissue: Human PANC1 Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24666_METTL14-Antibody-Western-Blot-NBP1-79389-img0004.jpg)
![Western Blot: METTL14 Antibody [NBP1-79389] - Titration: 0.2-1 ug/ml, Positive Control: NCI-H226 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24667_METTL14-Antibody-Western-Blot-NBP1-79389-img0003.jpg)