C1orf51 Antibody
| Name | C1orf51 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-79508 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the middle region of human C1orf51The immunogen for this antibody is C1orf51. Peptide sequence GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CIART |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: C1orf51 Antibody [NBP1-79508] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15287_C1orf51%2520Antibody-Western%2520Blot-NBP1-79508-img0003.jpg)
Western Blot: C1orf51 Antibody [NBP1-79508] - Titration: 0.2-1 ug/ml, Positive Control: Human heart.