CHM Antibody

Name CHM Antibody
Supplier Novus Biologicals
Catalog NBP1-79946
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Horse
Antigen Synthetic peptide directed towards the N terminal of human CHMThe immunogen for this antibody is CHM. Peptide sequence LHVDSRSYYGGNWASFSFSGLLSWLKEYQENSDIVSDSPVWQDQILENEE.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CHM
Supplier Page Shop

Product images