APPD Antibody

Name APPD Antibody
Supplier Novus Biologicals
Catalog NBP1-79945
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human APPDThe immunogen for this antibody is APPD. Peptide sequence QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PLEKHF1
Conjugate Unconjugated
Supplier Page Shop