MEF2B Antibody

Name MEF2B Antibody
Supplier Novus Biologicals
Catalog NBP1-80218
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the C terminal of human MEF2B. Peptide sequence PVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLL.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Mef2b
Conjugate Unconjugated
Supplier Page Shop

Product images