DNASE1L2 Antibody
| Name | DNASE1L2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-91429 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Rat |
| Antigen | Synthetic peptide directed towards the middle region of human LOC100364462. Peptide sequence LIPLHAAPNQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKAH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DNASE1L2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DNASE1L2 Antibody [NBP1-91429] - Titration: 0.2-1 ug/ml, Positive Control: Rat Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/15738_DNASE1L2-Antibody-Western-Blot-NBP1-91429-img0006.jpg)
Western Blot: DNASE1L2 Antibody [NBP1-91429] - Titration: 0.2-1 ug/ml, Positive Control: Rat Muscle.