DENR Antibody (1H3)
| Name | DENR Antibody (1H3) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008562-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 1H3 |
| Applications | WB ELISA Gene Silencing |
| Species Reactivities | Human |
| Antigen | DENR (NP_003668, 1 a.a. - 81 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGIS |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | DENR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ( Cat # H00008562-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody (M01), clone 1H3 (Cat # H00008562-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11611_DENR-Antibody-(1H3)-Western-Blot-H00008562-M01-img0003.jpg)
Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR over-expressed 293 cell line, cotransfected with DENR Validated Chimera RNAi ( Cat # H00008562-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with DENR monoclonal antibody (M01), clone 1H3 (Cat # H00008562-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
![Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3.Lane 1: DENR transfected lysate(22.092 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11612_DENR%2520Antibody%2520(1H3)-Western%2520Blot-H00008562-M01-img0004.jpg)
Western Blot: DENR Antibody (1H3) [H00008562-M01] - Analysis of DENR expression in transfected 293T cell line by DENR monoclonal antibody (M01), clone 1H3.Lane 1: DENR transfected lysate(22.092 KDa).Lane 2: Non-transfected lysate.