Centrin 2 Antibody (3F8)
| Name | Centrin 2 Antibody (3F8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00001069-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG1 Kappa |
| Clone | 3F8 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CETN2 (NP_004335 85 a.a. - 172 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CETN2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Sandwich ELISA: Centrin 2 Antibody (3F8) [H00001069-M01] - Detection limit for recombinant GST tagged CETN2 is approximately 0.1ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10703_Centrin%25202%2520Antibody%2520(3F8)-Sandwich%2520ELISA-H00001069-M01-img0002.jpg)
Sandwich ELISA: Centrin 2 Antibody (3F8) [H00001069-M01] - Detection limit for recombinant GST tagged CETN2 is approximately 0.1ng/ml as a capture antibody.