| Name | THRSP Antibody (2F8) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007069-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 2F8 |
| Applications | ELISA IHC-P |
| Species Reactivities | Human |
| Antigen | THRSP (NP_003242.1, 1 a.a. - 84 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | THRSP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |