TCL1A Antibody (1C4)

• Supplier: Novus Biologicals
• Catalog: H00008115-M06
• Prices: $359.00
• Sizes: 100 µg
• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b Kappa
• Clone: 1C4
• Applications: WB ELISA ICC/IF
• Species Reactivities: Human
• Antigen: TCL1A (NP_068801.1 61 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
• Purity/Format: IgG purified
• Description: Mouse Monoclonal
• Gene: TCL1A
• Conjugate: Unconjugated