Name | TCL1A Antibody (1C4) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00008115-M06 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2b Kappa |
Clone | 1C4 |
Applications | WB ELISA ICC/IF |
Species Reactivities | Human |
Antigen | TCL1A (NP_068801.1 61 a.a. - 114 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | TCL1A |
Conjugate | Unconjugated |
Supplier Page | Shop |