CDC2L5 Antibody (3G1)
| Name | CDC2L5 Antibody (3G1) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00008621-M02 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 3G1 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | CDC2L5 (AAH01274, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLPEDKEADSLRGNISVKAVKKEVEKKLRCLLADLPLPPELPGGDDLSKSPEEKKTATQLHSKRRPKICGPRYGETKEKDIDWGKRCVDK |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | CDK13 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CDC2L5 Antibody (3G1) [H00008621-M02] - Analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1.Lane 1: CDC2L5 transfected lysate(37 KDa).Lane 2: Non-transfected lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10185_CDC2L5%2520Antibody%2520(3G1)-Western%2520Blot-H00008621-M02-img0004.jpg)
Western Blot: CDC2L5 Antibody (3G1) [H00008621-M02] - Analysis of CDC2L5 expression in transfected 293T cell line by CDC2L5 monoclonal antibody (M02), clone 3G1.Lane 1: CDC2L5 transfected lysate(37 KDa).Lane 2: Non-transfected lysate.
![Sandwich ELISA: CDC2L5 Antibody (3G1) [H00008621-M02] - Detection limit for recombinant GST tagged CDC2L5 is approximately 0.03ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/10186_CDC2L5-Antibody-(3G1)-Sandwich-ELISA-H00008621-M02-img0003.jpg)
Sandwich ELISA: CDC2L5 Antibody (3G1) [H00008621-M02] - Detection limit for recombinant GST tagged CDC2L5 is approximately 0.03ng/ml as a capture antibody.