Name | FGF-8 Antibody (3H2) |
---|---|
Supplier | Novus Biologicals |
Catalog | H00002253-M06 |
Prices | $359.00 |
Sizes | 100 µg |
Host | Mouse |
Clonality | Monoclonal |
Isotype | IgG2a Kappa |
Clone | 3H2 |
Applications | WB ELISA |
Species Reactivities | Human |
Antigen | FGF8 (NP_149354 65 a.a. - 133 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSR VRVRGAETGLYICMNKKGK |
Purity/Format | IgG purified |
Description | Mouse Monoclonal |
Gene | FGF8 |
Conjugate | Unconjugated |
Supplier Page | Shop |