ZIC3 Antibody (4F7)
| Name | ZIC3 Antibody (4F7) |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | H00007547-M01 |
| Prices | $359.00 |
| Sizes | 100 µg |
| Host | Mouse |
| Clonality | Monoclonal |
| Isotype | IgG2a Kappa |
| Clone | 4F7 |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Antigen | ZIC3 (NP_003404.1, 182 a.a. - 274 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQVHLGLRGELFGRADPYRPVASPRTDPYAAGAQFPNYSPMNMNMGVNVAAHHGPGAFFRYMRQPIKQELSCKWIDEAQLSRPKKSCDRTFST |
| Purity/Format | IgG purified |
| Description | Mouse Monoclonal |
| Gene | ZIC3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: ZIC3 Antibody (3F7) [H00007547-M01] - detection against Immunogen (36.23 KDa).](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11987_ZIC3-Antibody-(3F7)-Western-Blot-H00007547-M01-img0002.jpg)
![Sandwich ELISA: ZIC3 Antibody (3F7) [H00007547-M01] - Detection limit for recombinant GST tagged ZIC3 is approximately 10ng/ml as a capture antibody.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11988_ZIC3%2520Antibody%2520(3F7)-Sandwich%2520ELISA-H00007547-M01-img0003.jpg)