BHLHB5 Antibody
| Name | BHLHB5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-39016 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AAAAALHPALGAYEQAAGYPFSAGLPPAASCPEKCALFNSVSSSLCKQCTE |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | BHLHB5 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | BHLHE22 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: BHLHB5 Antibody [NBP2-39016] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23176_BHLHB5%2520Antibody-Immunohistochemistry-NBP2-39016-img0001.jpg)
Immunohistochemistry: BHLHB5 Antibody [NBP2-39016] - Staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.