CDC42BPG Antibody
| Name | CDC42BPG Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38938 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: SNDIFQVGECRRVQQLTLSPSAGLLVVLCGRGPSVRLFALAELENIEVAGAKIPESRGCQVLAAGSILQARTPVLCV |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | CDC42BPG Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CDC42BPG |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: CDC42BPG Antibody [NBP2-38938] - Staining of human esophagus shows strong positivity in squamous epithelial cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/716_CDC42BPG%2520Antibody-Immunohistochemistry-NBP2-38938-img0001.jpg)
Immunohistochemistry: CDC42BPG Antibody [NBP2-38938] - Staining of human esophagus shows strong positivity in squamous epithelial cells.