Girdin Antibody
| Name | Girdin Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38387 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: VPDDISTGKRRKELGAMAFSTTAINFSTVNSSAGFRSKQLVNNKDTTSFEDISPQGVSDDSSTGSRVHASRPAS |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Girdin Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | CCDC88A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Girdin Antibody [NBP2-38387] - Staining of human appendix shows leukocyte positivity in Germinal center.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3583_Girdin%2520Antibody-Immunohistochemistry-NBP2-38387-img0001.jpg)
Immunohistochemistry: Girdin Antibody [NBP2-38387] - Staining of human appendix shows leukocyte positivity in Germinal center.