IRF7 Antibody
| Name | IRF7 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38678 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: HPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | IRF7 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IRF7 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: IRF7 Antibody [NBP2-38678] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8380_IRF7-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38678-img0002.jpg)
Immunocytochemistry/Immunofluorescence: IRF7 Antibody [NBP2-38678] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
![Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human tonsil shows weak nuclear positivity in germinal center and non-germinal center cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/8381_IRF7%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38678-img0003.jpg)
Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human tonsil shows weak nuclear positivity in germinal center and non-germinal center cells.