Karyopherin (importin) beta 3 Antibody
| Name | Karyopherin (importin) beta 3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38480 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human, Rat |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: AAEQQQFYLLLGNLLSPDNVVRKQAEETYEN |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Karyopherin (importin) beta 3 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | IPO5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: Karyopherin (importin) beta 3 Antibody [NBP2-38480] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/4722_Karyopherin%2520(importin)%2520beta%25203%2520Antibody-Immunohistochemistry-Paraffin-NBP2-38480-img0002.jpg)
Immunohistochemistry-Paraffin: Karyopherin (importin) beta 3 Antibody [NBP2-38480] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.