Vanin-1/VNN1 Antibody
| Name | Vanin-1/VNN1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38044 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQK |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Vanin-1/VNN1 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | VNN1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Vanin-1/VNN1 Antibody [NBP2-38044] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/10642_Vanin-1-VNN1%2520Antibody-Immunohistochemistry-NBP2-38044-img0001.jpg)
Immunohistochemistry: Vanin-1/VNN1 Antibody [NBP2-38044] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.