Nanos3 Antibody
| Name | Nanos3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-38011 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | Nanos3 Protein |
| Description | Rabbit Polyclonal |
| Gene | NANOS3 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: Nanos3 Antibody [NBP2-38011] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts and Leydig cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/3526_Nanos3%2520Antibody-Immunohistochemistry-NBP2-38011-img0001.jpg)
Immunohistochemistry: Nanos3 Antibody [NBP2-38011] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts and Leydig cells.