FA2H Antibody

Name FA2H Antibody
Supplier Novus Biologicals
Catalog NBP2-37957
Prices $419.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications IHC IHC-P
Species Reactivities Human, Rat
Antigen This antibody was developed against a recombinant protein corresponding to amino acids: LIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGS
Purity/Format Immunogen affinity purified
Blocking Peptide FA2H Protein
Description Rabbit Polyclonal
Gene FA2H
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.