MCPIP1/ZC3H12A Antibody
| Name | MCPIP1/ZC3H12A Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP2-37871 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | ICC/IF IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against a recombinant protein corresponding to amino acids: CTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCSLDGKKLGAQASPGSRQEGLTQTYAPSGRSLAP |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | MCPIP1/ZC3H12A Protein |
| Description | Rabbit Polyclonal |
| Gene | ZC3H12A |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Immunocytochemistry/Immunofluorescence: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human cell line U-251 MG shows localization to cytoplasmic bodies.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7121_MCPIP1-ZC3H12A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-37871-img0002.jpg)
Immunocytochemistry/Immunofluorescence: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human cell line U-251 MG shows localization to cytoplasmic bodies.
![Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/7122_MCPIP1-ZC3H12A%2520Antibody-Immunohistochemistry-Paraffin-NBP2-37871-img0003.jpg)
Immunohistochemistry-Paraffin: MCPIP1/ZC3H12A Antibody [NBP2-37871] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.