PLCZ1 Antibody
| Name | PLCZ1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80982 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | IHC IHC-P |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:YSENRKILLASNLAQFLTQEQYAAEMSKAIAFEIIQKYEPIEEVRKAHQMSLEGFTRYMDSRECLLFKNECRKVYQDMTHPLN |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | PLCZ1 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry-Paraffin: PLCZ1 Antibody [NBP1-80982] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23883_PLCZ1-Antibody-Immunohistochemistry-Paraffin-NBP1-80982-img0003.jpg)
Immunohistochemistry-Paraffin: PLCZ1 Antibody [NBP1-80982] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferus ducts.