ADCY10 Antibody
| Name | ADCY10 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-81766 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:NLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRLSETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSW |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | ADCY10 Recombinant Protein Antigen |
| Description | Rabbit Polyclonal |
| Gene | ADCY10 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: ADCY10 Antibody [NBP1-81766] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23916_ADCY10-Antibody-Immunohistochemistry-NBP1-81766-img0002.jpg)
Immunohistochemistry: ADCY10 Antibody [NBP1-81766] - Staining of human spleen shows strong cytoplasmic positivity in cells of red pulp.