KCNK3 Antibody
| Name | KCNK3 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-83070 |
| Prices | $419.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC |
| Species Reactivities | Human |
| Antigen | This antibody was developed against Recombinant Protein corresponding to amino acids:AVFDALESEPELIERQRLELRQQELRARYNLSQGGYEELERVVLRLKPHKAGVQ |
| Purity/Format | Immunogen affinity purified |
| Blocking Peptide | KCNK3 Protein |
| Description | Rabbit Polyclonal |
| Gene | KCNK3 |
| Supplier Page | Shop |
Product images
![Immunohistochemistry: KCNK3 Antibody [NBP1-83070] - Staining of human fallopian tube shows strong positivity in ciliated cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_4/23938_KCNK3-Antibody-Immunohistochemistry-NBP1-83070-img0003.jpg)
Immunohistochemistry: KCNK3 Antibody [NBP1-83070] - Staining of human fallopian tube shows strong positivity in ciliated cells.